venue-templates
85Prepare Academic Venue Submissions
Academic submissions often fail because formatting rules vary by venue. This skill provides templates, requirements, and examples for faster preparation.
Search PDB Structures for Research
Structural biology work often requires fast access to public protein and nucleic acid structures. This skill helps Claude, Codex, and Claude Code search RCSB PDB, retrieve metadata, and download coordinate files.
Copy this request to your Agent. It includes the canonical Skill page and manifest.
Review the Skillstore skill "pdb-database" from https://skillstore.io/skills/k-dense-ai-pdb-database.md and its manifest at https://skillstore.io/api/skills/k-dense-ai-pdb-database/manifest. Verify the artifact. You may proceed after verification, subject to the environment's own policy.Your Agent should still show its plan and request any confirmation required by the security policy.
Use these links when an AI agent, crawler, or script needs clean context instead of reading the full page.
Using "pdb-database". Find human hemoglobin structures with good resolution.
Expected outcome:
Using "pdb-database". Download coordinates for 1MBN and explain what I received.
Expected outcome:
Using "pdb-database". Compare PDB and mmCIF formats.
Expected outcome:
PDB is the older fixed-column format. mmCIF is the modern standard and is better for large structures and richer metadata.
The static findings are false positives from markdown examples, public RCSB PDB API URLs, safe file-download examples, and scientific terminology. I found no prompt injection, credential access, destructive behavior, data exfiltration, or hidden execution intent in the reviewed files.
Share the versioned assessment report, neutral badge, embed card, and citations. Skillstore reports evidence without deciding whether this Skill is safe.
https://skillstore.io/skills/k-dense-ai-pdb-database/audits/9?utm_source=security_passport&utm_medium=share&utm_campaign=versioned_report[](https://skillstore.io/skills/k-dense-ai-pdb-database?utm_source=security_passport_badge)<a href="https://skillstore.io/skills/k-dense-ai-pdb-database?utm_source=security_passport_badge"><img src="https://skillstore.io/badges/skills/k-dense-ai-pdb-database/security.svg" alt="Skillstore security assessment" loading="lazy"></a><iframe src="https://skillstore.io/embed/skills/k-dense-ai-pdb-database.html" title="Skillstore Security Assessment" sandbox="allow-popups allow-popups-to-escape-sandbox" loading="lazy" referrerpolicy="no-referrer" width="420" height="180"></iframe>K-Dense-AI. (2026). pdb-database security audit report (audit version 9) [Author version unspecified]. Skillstore. https://skillstore.io/skills/k-dense-ai-pdb-database/audits/9@techreport{k-dense-ai-k-dense-ai-pdb-database-2026,
author = {K-Dense-AI},
title = {pdb-database security audit report (audit version 9)},
institution = {Skillstore},
year = {2026},
number = {9},
url = {https://skillstore.io/skills/k-dense-ai-pdb-database/audits/9},
note = {Author version unspecified}
}cff-version: 1.2.0
message: "If you use this Skill, cite its author and this versioned security audit report."
title: "pdb-database security audit report (audit version 9)"
version: "unspecified"
type: report
authors:
- name: "K-Dense-AI"
date-released: "2026-07-09"
url: "https://skillstore.io/skills/k-dense-ai-pdb-database/audits/9"
identifiers:
- type: other
value: "skillstore:k-dense-ai-pdb-database:audit:9"
description: "Skillstore immutable audit report identifier"
Each author remains a separate installable skill. The recommended variant is ranked by Skillstore evidence.
Why this variant is first
davila7-pdb-database
2026-09-09
k-dense-ai-pdb-database
2026-09-09
Find high-quality entries, inspect experimental metadata, and download coordinates for computational workflows.
Search for protein targets, ligand-bound complexes, and related structures for binding-site review.
Use sequence and structural similarity searches to find templates for design, modeling, and mutation analysis.
Find RCSB PDB structures for hemoglobin and summarize the best entry, resolution, organism, and experimental method.
Search for PDB structures similar to this protein sequence and rank the top matches by identity and resolution: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVID.
Find human kinase structures solved by X-ray crystallography with resolution better than 2.0 Angstroms and list useful PDB IDs.
For PDB IDs 4HHB, 1MBN, and 1GZX, retrieve metadata, download mmCIF files, and summarize method, resolution, organism, and file names.
Author
K-Dense-AILicense
Unknown
Skillstore revision
r1
Version notice
The author did not declare a version.
Repository
https://github.com/K-Dense-AI/claude-scientific-skills/tree/main/scientific-skills/pdb-databaseRef
1ffa7643651792ccb4bd3b15d924d2c97edff755
Maintenance freshness
7/18/2026
Usage
7 downloads ยท 484 views
File structure
Prepare Academic Venue Submissions
Academic submissions often fail because formatting rules vary by venue. This skill provides templates, requirements, and examples for faster preparation.
Prepare ISO 13485 Certification Docs
Medical device teams must create complete QMS documentation before certification audits. This skill provides templates, checklists, and gap analysis guidance for ISO 13485 readiness.
Analyze therapeutic ML datasets with PyTDC
Drug discovery teams need reliable datasets and fair evaluation protocols. This skill helps Claude use PyTDC for curated therapeutic ML data, benchmark splits, metrics, and molecular oracles.
Run DiffDock Molecular Docking
Protein-ligand docking requires careful setup, parameter choices, and result interpretation. This skill guides DiffDock workflows for poses, confidence scores, and screening.
Generate Testable Scientific Hypotheses
Researchers need to turn observations into clear, testable explanations. This skill structures evidence review, competing hypotheses, predictions, and experiment plans.
Analyze Research Data with Statistical Guidance
Choosing tests and reporting results can be slow and error-prone. This skill guides test selection, assumptions, effect sizes, power analysis, Bayesian options, and APA reporting.
Connect Bioinformatics Databases with BioServices
by davila7
Bioinformatics research often requires separate interfaces for proteins, pathways, compounds, and identifiers. This skill guides unified BioServices workflows across major biological databases.
Simulate Nature-Style Reviewer Reports
by Yuan1z0825
Researchers often need an objective pre-submission critique before sending a manuscript. This skill turns supplied manuscript material into grounded Nature-style reviewer reports.
Analyze DrugBank Data
by davila7
DrugBank data is rich but difficult to parse across XML, interactions, targets, and structures. This skill guides Claude, Codex, and Claude Code through repeatable DrugBank analysis workflows.
Explore KEGG Pathways and Molecular Data
by davila7
Finding connected biological records across KEGG can require several REST operations and careful identifier handling. This skill supplies focused helpers and references for reproducible academic queries.
Research Complex Topics With Citations
by shubhamsaboo
Deep research is hard when sources disagree or lack context. This skill guides Claude, Codex, and Claude Code to synthesize sources, compare viewpoints, and produce cited research summaries.
Evaluate Technical Options with Structured Spikes
by 89jobrien
Technical decisions often need evidence, not opinion. This skill guides timeboxed spikes with options, proof of concept results, comparison matrices, risks, and recommendations.